Class a: All alpha proteins [46456] (290 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
Protein Sigma70 [88948] (2 species) |
Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries) Uniprot Q9WX78 |
Domain d2a68f3: 2a68 F:74-257 [126200] Other proteins in same PDB: d2a68a1, d2a68a2, d2a68b1, d2a68b2, d2a68c_, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68m_, d2a68n_, d2a68o_, d2a68p1, d2a68p2 automated match to d1smyf3 protein/RNA complex; complexed with mg, rbt, zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 2a68 (more details), 2.5 Å
SCOPe Domain Sequences for d2a68f3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a68f3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]} kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad qart
Timeline for d2a68f3: