Lineage for d2a68c_ (2a68 C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574312Protein automated matches [190192] (4 species)
    not a true protein
  7. 2574330Species Thermus thermophilus [TaxId:274] [186932] (8 PDB entries)
  8. 2574335Domain d2a68c_: 2a68 C: [126195]
    Other proteins in same PDB: d2a68a1, d2a68a2, d2a68b1, d2a68b2, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68f3, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68n_, d2a68o_, d2a68p1, d2a68p2, d2a68p3
    automated match to d1iw7c_
    protein/RNA complex; complexed with mg, rbt, zn

Details for d2a68c_

PDB Entry: 2a68 (more details), 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin
PDB Compounds: (C:) DNA-directed RNA polymerase beta chain

SCOPe Domain Sequences for d2a68c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a68c_ e.29.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOPe Domain Coordinates for d2a68c_:

Click to download the PDB-style file with coordinates for d2a68c_.
(The format of our PDB-style files is described here.)

Timeline for d2a68c_: