Class a: All alpha proteins [46456] (290 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
Protein RNA polymerase omega subunit [63564] (3 species) |
Species Thermus thermophilus [TaxId:274] [74729] (11 PDB entries) Uniprot Q8RQE7; part of multichain biological unit |
Domain d2a68o_: 2a68 O: [126207] Other proteins in same PDB: d2a68a1, d2a68a2, d2a68b1, d2a68b2, d2a68c_, d2a68d_, d2a68f1, d2a68f2, d2a68f3, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68m_, d2a68n_, d2a68p1, d2a68p2, d2a68p3 automated match to d1iw7e_ protein/RNA complex; complexed with mg, rbt, zn |
PDB Entry: 2a68 (more details), 2.5 Å
SCOPe Domain Sequences for d2a68o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a68o_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]} aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d2a68o_: