Lineage for d2a68b1 (2a68 B:1-49,B:173-229)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. Protein RNA polymerase alpha [55259] (3 species)
  7. Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. Domain d2a68b1: 2a68 B:1-49,B:173-229 [126193]
    Other proteins in same PDB: d2a68a2, d2a68b2, d2a68c_, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68f3, d2a68k2, d2a68l2, d2a68m_, d2a68n_, d2a68o_, d2a68p1, d2a68p2, d2a68p3
    automated match to d1smya1
    protein/RNA complex; complexed with mg, rbt, zn

Details for d2a68b1

PDB Entry: 2a68 (more details), 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a68b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a68b1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d2a68b1 are not available.

Timeline for d2a68b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a68b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2a68a1, d2a68a2, d2a68c_, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68f3, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68m_, d2a68n_, d2a68o_, d2a68p1, d2a68p2, d2a68p3