Lineage for d1smya1 (1smy A:1-49,A:173-229)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958150Protein RNA polymerase alpha [55259] (3 species)
  7. 2958165Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2958170Domain d1smya1: 1smy A:1-49,A:173-229 [105774]
    Other proteins in same PDB: d1smya2, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyf3, d1smyk2, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2, d1smyp3
    complexed with g4p, mg, zn

Details for d1smya1

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1smya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smya1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d1smya1:

Click to download the PDB-style file with coordinates for d1smya1.
(The format of our PDB-style files is described here.)

Timeline for d1smya1: