![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
![]() | Protein Sigma70 [88661] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [88662] (11 PDB entries) Uniprot Q9WX78 |
![]() | Domain d1smyp1: 1smy P:258-318 [105791] Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf2, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp2, d1smyp3 complexed with g4p, mg, zn |
PDB Entry: 1smy (more details), 2.7 Å
SCOPe Domain Sequences for d1smyp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smyp1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d1smyp1: