| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) ![]() |
| Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
| Protein Sigma70 [88948] (2 species) |
| Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries) Uniprot Q9WX78 |
| Domain d1smyp3: 1smy P:74-257 [105793] Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2 complexed with g4p, mg, zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 1smy (more details), 2.7 Å
SCOPe Domain Sequences for d1smyp3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smyp3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart
Timeline for d1smyp3: