Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d1smyl2: 1smy L:50-172 [105787] Other proteins in same PDB: d1smya1, d1smyb1, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyf3, d1smyk1, d1smyl1, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2, d1smyp3 complexed with g4p, mg, zn |
PDB Entry: 1smy (more details), 2.7 Å
SCOPe Domain Sequences for d1smyl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smyl2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda vfs
Timeline for d1smyl2: