Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
Protein Sigma70 (SigA, RpoD) [88666] (4 species) Pfam PF03979 |
Species Thermus thermophilus [TaxId:274] [88667] (11 PDB entries) Uniprot Q9WX78 |
Domain d1smyp2: 1smy P:319-423 [105792] Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp3 complexed with g4p, mg, zn |
PDB Entry: 1smy (more details), 2.7 Å
SCOPe Domain Sequences for d1smyp2:
Sequence, based on SEQRES records: (download)
>d1smyp2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
>d1smyp2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg eevgaffgvtrerirqienkalrklkyhesrtrklrdfld
Timeline for d1smyp2: