SCOPe 2.08: Domain d2a68l2: 2a68 L:50-172

Lineage for d2a68l2 (2a68 L:50-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2a68l2: 2a68 L:50-172 [126204]
   Other proteins in same PDB: d2a68a1, d2a68b1, d2a68c_, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68f3, d2a68k1, d2a68l1, d2a68m_, d2a68n_, d2a68o_, d2a68p1, d2a68p2, d2a68p3
   automated match to d1smya2
   protein/RNA complex; complexed with mg, rbt, zn

Details for d2a68l2

PDB Entry: 2a68, 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin

PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a68l2:

Sequence; same for both SEQRES and ATOM records:

>d2a68l2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d2a68l2:

• d2a68l2 first appeared in SCOP 1.73
  
• d2a68l2 appears in SCOPe 2.07