Lineage for d2a68k2 (2a68 K:50-172)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004951Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 3004952Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 3004953Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 3004954Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 3004969Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 3004992Domain d2a68k2: 2a68 K:50-172 [126202]
    Other proteins in same PDB: d2a68a1, d2a68b1, d2a68c_, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68f3, d2a68k1, d2a68l1, d2a68m_, d2a68n_, d2a68o_, d2a68p1, d2a68p2, d2a68p3
    automated match to d1smya2
    protein/RNA complex; complexed with mg, rbt, zn

Details for d2a68k2

PDB Entry: 2a68 (more details), 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin
PDB Compounds: (K:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a68k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a68k2 d.181.1.1 (K:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d2a68k2:

Click to download the PDB-style file with coordinates for d2a68k2.
(The format of our PDB-style files is described here.)

Timeline for d2a68k2: