SCOPe 2.08: Domain d1zxib1: 1zxi B:6-146

Lineage for d1zxib1 (1zxi B:6-146)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (4 species)
   not a true protein

7. Species Oligotropha carboxidovorans [TaxId:504832] [230466] (1 PDB entry)

8. Domain d1zxib1: 1zxi B:6-146 [125774]
   Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib2, d1zxic1, d1zxic2, d1zxid1, d1zxid2, d1zxie2, d1zxif1, d1zxif2
   automated match to d1zxie1
   complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxib1

PDB Entry: 1zxi, 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans

PDB Compounds: (B:) Carbon monoxide dehydrogenase large chain

SCOPe Domain Sequences for d1zxib1:

Sequence; same for both SEQRES and ATOM records:

>d1zxib1 d.41.1.0 (B:6-146) automated matches {Oligotropha carboxidovorans [TaxId: 504832]}
tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
ryvaadaielvevdyeplpvl

Timeline for d1zxib1:

• d1zxib1 first appeared in SCOP 1.73
  
• d1zxib1 appears in SCOPe 2.07