SCOPe 2.08: Domain d1zxic1: 1zxi C:178-287

Lineage for d1zxic1 (1zxi C:178-287)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family

6. Protein automated matches [232090] (5 species)
   not a true protein

7. Species Oligotropha carboxidovorans [TaxId:504832] [346370] (1 PDB entry)

8. Domain d1zxic1: 1zxi C:178-287 [125776]
   Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic2, d1zxid1, d1zxid2, d1zxie1, d1zxie2, d1zxif2
   automated match to d1qj2c4
   complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxic1

PDB Entry: 1zxi, 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans

PDB Compounds: (C:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1zxic1:

Sequence; same for both SEQRES and ATOM records:

>d1zxic1 d.87.2.0 (C:178-287) automated matches {Oligotropha carboxidovorans [TaxId: 504832]}
ghgyayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarak

Timeline for d1zxic1:

• d1zxic1 first appeared in SCOP 1.73
  
• d1zxic1 appears in SCOPe 2.07