Lineage for d1zxic2 (1zxi C:1-177)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547987Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2548046Protein automated matches [232070] (2 species)
    not a true protein
  7. Species Oligotropha carboxidovorans [TaxId:504832] [346386] (1 PDB entry)
  8. 2548073Domain d1zxic2: 1zxi C:1-177 [125777]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxid1, d1zxid2, d1zxie1, d1zxie2, d1zxif1
    automated match to d1n62c2
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxic2

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (C:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1zxic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxic2 d.145.1.3 (C:1-177) automated matches {Oligotropha carboxidovorans [TaxId: 504832]}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOPe Domain Coordinates for d1zxic2:

Click to download the PDB-style file with coordinates for d1zxic2.
(The format of our PDB-style files is described here.)

Timeline for d1zxic2: