![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins) automatically mapped to Pfam PF00941 |
![]() | Protein automated matches [232070] (2 species) not a true protein |
![]() | Domain d1zxif2: 1zxi F:1-177 [125781] Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxid1, d1zxid2, d1zxie1, d1zxie2, d1zxif1 automated match to d1n62c2 complexed with cu, cum, fad, fes, mcn, po4 |
PDB Entry: 1zxi (more details), 1.7 Å
SCOPe Domain Sequences for d1zxif2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxif2 d.145.1.3 (F:1-177) automated matches {Oligotropha carboxidovorans [TaxId: 504832]} mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt
Timeline for d1zxif2: