Lineage for d1zxia1 (1zxi A:82-163)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998451Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1998452Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1998453Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 protein domains)
  6. 1998476Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (3 species)
  7. 1998482Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [47749] (6 PDB entries)
  8. 1998493Domain d1zxia1: 1zxi A:82-163 [125772]
    Other proteins in same PDB: d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxic2, d1zxid2, d1zxie1, d1zxie2, d1zxif1, d1zxif2
    automated match to d1n62a1
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxia1

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: Reconstituted CO dehydrogenase from Oligotropha carboxidovorans
PDB Compounds: (A:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1zxia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxia1 a.56.1.1 (A:82-163) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvpfee

SCOPe Domain Coordinates for d1zxia1:

Click to download the PDB-style file with coordinates for d1zxia1.
(The format of our PDB-style files is described here.)

Timeline for d1zxia1: