Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
Protein automated matches [232090] (5 species) not a true protein |
Domain d1zxif1: 1zxi F:178-286 [125780] Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic2, d1zxid1, d1zxid2, d1zxie1, d1zxie2, d1zxif2 automated match to d1qj2c4 complexed with cu, cum, fad, fes, mcn, po4 |
PDB Entry: 1zxi (more details), 1.7 Å
SCOPe Domain Sequences for d1zxif1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxif1 d.87.2.0 (F:178-286) automated matches {Oligotropha carboxidovorans [TaxId: 504832]} ghgyayeklkrkigdyataaaavvltmsggkcvsasigltnvantplwaeeagkvlvgta ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara
Timeline for d1zxif1: