Lineage for d1zxie2 (1zxi E:147-809)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540595Protein automated matches [230468] (3 species)
    not a true protein
  7. 2540619Species Oligotropha carboxidovorans [TaxId:504832] [230469] (1 PDB entry)
  8. 2540621Domain d1zxie2: 1zxi E:147-809 [230470]
    Other proteins in same PDB: d1zxia1, d1zxia2, d1zxib1, d1zxic1, d1zxic2, d1zxid1, d1zxid2, d1zxie1, d1zxif1, d1zxif2
    automated match to d1n62b2
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxie2

PDB Entry: 1zxi (more details), 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (E:) Carbon monoxide dehydrogenase large chain

SCOPe Domain Sequences for d1zxie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxie2 d.133.1.1 (E:147-809) automated matches {Oligotropha carboxidovorans [TaxId: 504832]}
vdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtdatfakaevvskdm
ftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisglpehkihviapd
igggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardyhmttelaatkdg
kilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdgvytnkasggvay
rcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymaplgweydsgnypla
mkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagpskncdilgvsmf
dsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimieegntdtapyglg
tygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfrvkglpekfktmk
elawasynspppnlepgleavnyydppnmtypfgayfcimdididtgvaktrrfyalddc
gtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflptavetpkwetdy
tvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphdawrlwkvgeqlg
lhv

SCOPe Domain Coordinates for d1zxie2:

Click to download the PDB-style file with coordinates for d1zxie2.
(The format of our PDB-style files is described here.)

Timeline for d1zxie2: