Lineage for d1zxid1 (1zxi D:82-160)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (3 species)
  7. Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [47749] (6 PDB entries)
  8. Domain d1zxid1: 1zxi D:82-160 [125778]
    Other proteins in same PDB: d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxic2, d1zxid2, d1zxie1, d1zxie2, d1zxif1, d1zxif2
    automated match to d1n62a1
    complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxid1

PDB Entry: 1zxi (more details), 1.7000000000000002 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans
PDB Compounds: (D:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1zxid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxid1 a.56.1.1 (D:82-160) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvp

SCOPe Domain Coordinates for d1zxid1 are not available.

Timeline for d1zxid1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zxid2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zxia1, d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxic2, d1zxie1, d1zxie2, d1zxif1, d1zxif2