Lineage for d1xb4d1 (1xb4 D:2-125)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983392Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 protein domains)
    duplication: tandem repeat of two "winged-helix" domains
  6. 1983393Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species)
  7. 1983394Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries)
    Uniprot P47142
  8. 1983401Domain d1xb4d1: 1xb4 D:2-125 [121838]

Details for d1xb4d1

PDB Entry: 1xb4 (more details), 3.1 Å

PDB Description: Crystal structure of subunit VPS25 of the endosomal trafficking complex ESCRT-II
PDB Compounds: (D:) Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region

SCOPe Domain Sequences for d1xb4d1:

Sequence, based on SEQRES records: (download)

>d1xb4d1 a.4.5.54 (D:2-125) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
salppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindneldsg
stdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttry
filw

Sequence, based on observed residues (ATOM records): (download)

>d1xb4d1 a.4.5.54 (D:2-125) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
salppvysfpplytrqptrrqqistwidiisqycktkkiwymsvdgtvinnlfnnediqr
svsqvfideiwsqmtkegkclpiyfilw

SCOPe Domain Coordinates for d1xb4d1:

Click to download the PDB-style file with coordinates for d1xb4d1.
(The format of our PDB-style files is described here.)

Timeline for d1xb4d1: