PDB entry 1xb4

View 1xb4 on RCSB PDB site
Description: Crystal structure of subunit VPS25 of the endosomal trafficking complex ESCRT-II
Class: unknown function
Keywords: winged helix, UNKNOWN FUNCTION
Deposited on 2004-08-27, released 2005-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.327
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YJR102C, J1957
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xb4a1, d1xb4a2
  • Chain 'B':
    Compound: Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YJR102C, J1957
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xb4b1, d1xb4b2
  • Chain 'C':
    Compound: Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YJR102C, J1957
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xb4c1, d1xb4c2
  • Chain 'D':
    Compound: Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YJR102C, J1957
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xb4d1, d1xb4d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xb4A (A:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
    gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
    yfilwksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkpl
    cdrnratmlkdendkviaikvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb4A (A:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindknlfn
    nediqrsvsqvfideiwsqmtkegkclpidqsgrrsttttryfilwksldswaslilqwf
    edsgklnqvitlyelsdetvnwefhrmpesllyyclkplcdrnratmlkdendkviaikv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xb4B (B:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
    gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
    yfilwksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkpl
    cdrnratmlkdendkviaikvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb4B (B:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvnlfnnedi
    qrsvsqvfideiwsqmtkegkclpidqsgrrssnttttryfilwksldswaslilqwfed
    sgklnqvitlyelseetvnwefhrmpesllyyclkplcdrnratmlkdendkviaikvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xb4C (C:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
    gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
    yfilwksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkpl
    cdrnratmlkdendkviaikvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb4C (C:)
    alppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnknlfnn
    ediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttryfilwksldswaslilqw
    fedsgklnqvitlyelsetvnwefhrmpesllyyclkplcdrnratmlkdendkviaikv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xb4D (D:)
    msalppvysfpplytrqpnsltrrqqistwidiisqycktkkiwymsvdgtvindnelds
    gstdnddskkisknlfnnediqrsvsqvfideiwsqmtkegkclpidqsgrrssnttttr
    yfilwksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkpl
    cdrnratmlkdendkviaikvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb4D (D:)
    salppvysfpplytrqptrrqqistwidiisqycktkkiwymsvdgtvinnlfnnediqr
    svsqvfideiwsqmtkegkclpiyfilwksldswaslilqwfgklnqvitlyelsvnwef
    hrmpesllyyclkplcdrntmlkdendkviaikv