Lineage for d1xb4b2 (1xb4 B:126-202)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
    duplication: tandem repeat of two "winged-helix" domains
  6. Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries)
    Uniprot P47142
  8. Domain d1xb4b2: 1xb4 B:126-202 [121835]
    automated match to d1xb4a2

Details for d1xb4b2

PDB Entry: 1xb4 (more details), 3.1 Å

PDB Description: crystal structure of subunit vps25 of the endosomal trafficking complex escrt-ii
PDB Compounds: (B:) Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region

SCOPe Domain Sequences for d1xb4b2:

Sequence, based on SEQRES records: (download)

>d1xb4b2 a.4.5.54 (B:126-202) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnr
atmlkdendkviaikvv

Sequence, based on observed residues (ATOM records): (download)

>d1xb4b2 a.4.5.54 (B:126-202) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ksldswaslilqwfedsgklnqvitlyelseetvnwefhrmpesllyyclkplcdrnrat
mlkdendkviaikvv

SCOPe Domain Coordinates for d1xb4b2 are not available.

Timeline for d1xb4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xb4b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xb4a1, d1xb4a2, d1xb4c1, d1xb4c2, d1xb4d1, d1xb4d2