SCOPe 2.08: Domain d1xb4c2: 1xb4 C:126-201

Lineage for d1xb4c2 (1xb4 C:126-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
   duplication: tandem repeat of two "winged-helix" domains

6. Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries)
   Uniprot P47142

8. Domain d1xb4c2: 1xb4 C:126-201 [121837]
   automated match to d1xb4a2

Details for d1xb4c2

PDB Entry: 1xb4, 3.1 Å

PDB Description: crystal structure of subunit vps25 of the endosomal trafficking complex escrt-ii

PDB Compounds: (C:) Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region

SCOPe Domain Sequences for d1xb4c2:

Sequence, based on SEQRES records:

>d1xb4c2 a.4.5.54 (C:126-201) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnr
atmlkdendkviaikv

Sequence, based on observed residues (ATOM records):

>d1xb4c2 a.4.5.54 (C:126-201) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ksldswaslilqwfedsgklnqvitlyelsetvnwefhrmpesllyyclkplcdrnratm
lkdendkviaikv

Timeline for d1xb4c2:

• d1xb4c2 first appeared in SCOP 1.73
  
• d1xb4c2 appears in SCOPe 2.07