Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins) duplication: tandem repeat of two "winged-helix" domains |
Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries) Uniprot P47142 |
Domain d1xb4a2: 1xb4 A:126-201 [121833] automated match to d1xb4a2 |
PDB Entry: 1xb4 (more details), 3.1 Å
SCOPe Domain Sequences for d1xb4a2:
Sequence, based on SEQRES records: (download)
>d1xb4a2 a.4.5.54 (A:126-201) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnr atmlkdendkviaikv
>d1xb4a2 a.4.5.54 (A:126-201) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ksldswaslilqwfedsgklnqvitlyelsdetvnwefhrmpesllyyclkplcdrnrat mlkdendkviaikv
Timeline for d1xb4a2: