SCOPe 2.08: Domain d1vldq1: 1vld Q:729-875

Lineage for d1vldq1 (1vld Q:729-875)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)
   Uniprot P80563

8. Domain d1vldq1: 1vld Q:729-875 [108752]
   Other proteins in same PDB: d1vldm2, d1vldn1, d1vldn2, d1vldo2, d1vldp1, d1vldp2, d1vldq2, d1vldr1, d1vldr2, d1vlds2, d1vldt1, d1vldt2, d1vldu2, d1vldv1, d1vldv2, d1vldw2, d1vldx1, d1vldx2
   complexed with 4mo, act, ca, mgd, sf4
   complexed with 4mo, act, ca, mgd, sf4

Details for d1vldq1

PDB Entry: 1vld, 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

PDB Compounds: (Q:) Pyrogallol hydroxytransferase large subunit

SCOPe Domain Sequences for d1vldq1:

Sequence; same for both SEQRES and ATOM records:

>d1vldq1 b.52.2.2 (Q:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

Timeline for d1vldq1:

• d1vldq1 first appeared in SCOP 1.69
  
• d1vldq1 appears in SCOPe 2.07