Lineage for d1vldu1 (1vld U:729-875)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802680Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2802749Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)
  7. 2802750Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)
    Uniprot P80563
  8. 2802785Domain d1vldu1: 1vld U:729-875 [108760]
    Other proteins in same PDB: d1vldm2, d1vldn1, d1vldn2, d1vldo2, d1vldp1, d1vldp2, d1vldq2, d1vldr1, d1vldr2, d1vlds2, d1vldt1, d1vldt2, d1vldu2, d1vldv1, d1vldv2, d1vldw2, d1vldx1, d1vldx2
    complexed with 4mo, act, ca, mgd, sf4
    complexed with 4mo, act, ca, mgd, sf4

Details for d1vldu1

PDB Entry: 1vld (more details), 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici
PDB Compounds: (U:) Pyrogallol hydroxytransferase large subunit

SCOPe Domain Sequences for d1vldu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vldu1 b.52.2.2 (U:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

SCOPe Domain Coordinates for d1vldu1:

Click to download the PDB-style file with coordinates for d1vldu1.
(The format of our PDB-style files is described here.)

Timeline for d1vldu1: