SCOPe 2.08: Domain d1vldt1: 1vld T:196-274

Lineage for d1vldt1 (1vld T:196-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.5: Cna protein B-type domain [49478] (2 families)

5. Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
   Pfam PF05738

6. Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
   the penultimate strand is in the other beta-sheet than in the Cna repeats

7. Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
   Uniprot P80564

8. Domain d1vldt1: 1vld T:196-274 [108758]
   Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn2, d1vldo1, d1vldo2, d1vldp2, d1vldq1, d1vldq2, d1vldr2, d1vlds1, d1vlds2, d1vldt2, d1vldu1, d1vldu2, d1vldv2, d1vldw1, d1vldw2, d1vldx2
   complexed with 4mo, act, ca, mgd, sf4
   complexed with 4mo, act, ca, mgd, sf4

Details for d1vldt1

PDB Entry: 1vld, 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

PDB Compounds: (T:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1vldt1:

Sequence; same for both SEQRES and ATOM records:

>d1vldt1 b.3.5.1 (T:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

Timeline for d1vldt1:

• d1vldt1 first appeared in SCOP 1.69
  
• d1vldt1 appears in SCOPe 2.07