Lineage for d1vldw2 (1vld W:1-728)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140604Protein Transhydroxylase alpha subunit, AthL [110729] (1 species)
  7. 2140605Species Pelobacter acidigallici [TaxId:35816] [110730] (6 PDB entries)
    Uniprot P80563
  8. 2140641Domain d1vldw2: 1vld W:1-728 [108765]
    Other proteins in same PDB: d1vldm1, d1vldn1, d1vldn2, d1vldo1, d1vldp1, d1vldp2, d1vldq1, d1vldr1, d1vldr2, d1vlds1, d1vldt1, d1vldt2, d1vldu1, d1vldv1, d1vldv2, d1vldw1, d1vldx1, d1vldx2
    complexed with 4mo, act, ca, mgd, sf4
    complexed with 4mo, act, ca, mgd, sf4

Details for d1vldw2

PDB Entry: 1vld (more details), 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici
PDB Compounds: (W:) Pyrogallol hydroxytransferase large subunit

SCOPe Domain Sequences for d1vldw2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vldw2 c.81.1.1 (W:1-728) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]}
mgevvrltnsstggpvfvyvkdgkiirmtpmdfddavdapswkieargktftpprktsia
pytagfksmiysdlripypmkrksfdpngernpqlrgaglskqdpwsdyeriswdeatdi
vvaeinrikhaygpsailstpsshhmwgnvgyrhstyfrfmnmmgftyadhnpdswegwh
wggmhmwgfswrlgnpeqydlledglkhaemivfwssdpetnsgiyagfesnirrqwlkd
lgvdfvfidphmnhtarlvadkwfspkigtdhalsfaiaytwlkedsydkeyvaanahgf
eewadyvlgktdgtpktcewaeeesgvpaceiralarqwakkntylaagglggwggacra
shgiewargmialatmqgmgkpgsnmwsttqgvpldyefyfpgyaeggisgdcensaagf
kfawrmfdgkttfpspsnlntsagqhiprlkipecimggkfqwsgkgfaggdishqlhqy
eypapgyskikmfwkyggphlgtmtatnryakmythdslefvvsqsiwfegevpfadiil
pactnferwdisefancsgyipdnyqlcnhrvislqakciepvgesmsdyeiyrlfakkl
nieemfsegkdelawceqyfnatdmpkymtwdeffkkgyfvvpdnpnrkktvalrwfaeg
rekdtpdwgprlnnqvcrkglqtttgkvefiatslknfeeqgyidehrpsmhtyvpawes
qkhsplav

SCOPe Domain Coordinates for d1vldw2:

Click to download the PDB-style file with coordinates for d1vldw2.
(The format of our PDB-style files is described here.)

Timeline for d1vldw2: