Class b: All beta proteins [48724] (180 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein Transhydroxylase alpha subunit, AthL [110250] (1 species) |
Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries) Uniprot P80563 |
Domain d1vldw1: 1vld W:729-875 [108764] Other proteins in same PDB: d1vldm2, d1vldn1, d1vldn2, d1vldo2, d1vldp1, d1vldp2, d1vldq2, d1vldr1, d1vldr2, d1vlds2, d1vldt1, d1vldt2, d1vldu2, d1vldv1, d1vldv2, d1vldw2, d1vldx1, d1vldx2 complexed with 4mo, act, ca, mgd, sf4 complexed with 4mo, act, ca, mgd, sf4 |
PDB Entry: 1vld (more details), 2.35 Å
SCOPe Domain Sequences for d1vldw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vldw1 b.52.2.2 (W:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi skyacgmanntalveiekwdgdkyeiy
Timeline for d1vldw1: