SCOPe 2.08: Domain d1vldv2: 1vld V:1-195

Lineage for d1vldv2 (1vld V:1-195)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
   Uniprot P80564

8. Domain d1vldv2: 1vld V:1-195 [108763]
   Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn1, d1vldo1, d1vldo2, d1vldp1, d1vldq1, d1vldq2, d1vldr1, d1vlds1, d1vlds2, d1vldt1, d1vldu1, d1vldu2, d1vldv1, d1vldw1, d1vldw2, d1vldx1
   complexed with 4mo, act, ca, mgd, sf4
   complexed with 4mo, act, ca, mgd, sf4

Details for d1vldv2

PDB Entry: 1vld, 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

PDB Compounds: (V:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1vldv2:

Sequence; same for both SEQRES and ATOM records:

>d1vldv2 d.58.1.5 (V:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

Timeline for d1vldv2:

• d1vldv2 first appeared in SCOP 1.69
  
• d1vldv2 appears in SCOPe 2.07