![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) ![]() |
![]() | Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
![]() | Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
![]() | Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) Uniprot P80564 |
![]() | Domain d1vldn1: 1vld N:196-274 [108746] Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn2, d1vldo1, d1vldo2, d1vldp2, d1vldq1, d1vldq2, d1vldr2, d1vlds1, d1vlds2, d1vldt2, d1vldu1, d1vldu2, d1vldv2, d1vldw1, d1vldw2, d1vldx2 complexed with 4mo, act, ca, mgd, sf4 complexed with 4mo, act, ca, mgd, sf4 |
PDB Entry: 1vld (more details), 2.35 Å
SCOPe Domain Sequences for d1vldn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vldn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks ysdtvviddksvdlgfikl
Timeline for d1vldn1: