| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) ![]() |
| Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
| Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
| Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) Uniprot P80564 |
| Domain d1vldx1: 1vld X:196-274 [108766] Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn2, d1vldo1, d1vldo2, d1vldp2, d1vldq1, d1vldq2, d1vldr2, d1vlds1, d1vlds2, d1vldt2, d1vldu1, d1vldu2, d1vldv2, d1vldw1, d1vldw2, d1vldx2 complexed with 4mo, act, ca, mgd, sf4 complexed with 4mo, act, ca, mgd, sf4 |
PDB Entry: 1vld (more details), 2.35 Å
SCOPe Domain Sequences for d1vldx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vldx1 b.3.5.1 (X:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl
Timeline for d1vldx1: