Lineage for d1i3rc1 (1i3r C:82-182)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288908Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 288963Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (7 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 288973Domain d1i3rc1: 1i3r C:82-182 [61624]
    Other proteins in same PDB: d1i3ra2, d1i3rb1, d1i3rb2, d1i3rc2, d1i3rd1, d1i3rd2, d1i3re2, d1i3rf1, d1i3rf2, d1i3rg2, d1i3rh1, d1i3rh2

Details for d1i3rc1

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule

SCOP Domain Sequences for d1i3rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3rc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOP Domain Coordinates for d1i3rc1:

Click to download the PDB-style file with coordinates for d1i3rc1.
(The format of our PDB-style files is described here.)

Timeline for d1i3rc1: