| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
| Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (7 PDB entries) probably orthologous to the human HLA-DR group |
| Domain d1i3rg1: 1i3r G:82-182 [61632] Other proteins in same PDB: d1i3ra2, d1i3rb1, d1i3rb2, d1i3rc2, d1i3rd1, d1i3rd2, d1i3re2, d1i3rf1, d1i3rf2, d1i3rg2, d1i3rh1, d1i3rh2 complexed with nag; mutant |
PDB Entry: 1i3r (more details), 2.4 Å
SCOP Domain Sequences for d1i3rg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3rg1 b.1.1.2 (G:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
Timeline for d1i3rg1: