![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (7 PDB entries) probably orthologous to the human HLA-DR group |
![]() | Domain d1i3rf1: 1i3r F:121-216 [61630] Other proteins in same PDB: d1i3ra1, d1i3ra2, d1i3rb2, d1i3rc1, d1i3rc2, d1i3rd2, d1i3re1, d1i3re2, d1i3rf2, d1i3rg1, d1i3rg2, d1i3rh2 |
PDB Entry: 1i3r (more details), 2.4 Å
SCOP Domain Sequences for d1i3rf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3rf1 b.1.1.2 (F:121-216) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group} veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt fqtlvmletvpqsgevytcqvehpsltdpvtvewka
Timeline for d1i3rf1: