Lineage for d1i3re2 (1i3r E:1-81)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326895Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species)
  7. 326957Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (7 PDB entries)
  8. 326968Domain d1i3re2: 1i3r E:1-81 [61629]
    Other proteins in same PDB: d1i3ra1, d1i3rb1, d1i3rb2, d1i3rc1, d1i3rd1, d1i3rd2, d1i3re1, d1i3rf1, d1i3rf2, d1i3rg1, d1i3rh1, d1i3rh2

Details for d1i3re2

PDB Entry: 1i3r (more details), 2.4 Å

PDB Description: crystal structure of a mutant iek class ii mhc molecule

SCOP Domain Sequences for d1i3re2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3re2 d.19.1.1 (E:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK}
ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavnkanldvmkersnntp

SCOP Domain Coordinates for d1i3re2:

Click to download the PDB-style file with coordinates for d1i3re2.
(The format of our PDB-style files is described here.)

Timeline for d1i3re2: