Details for d2bcce2

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (E:)

SCOP Domain Sequences for d2bcce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus)}
shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
smsasadvl

SCOP Domain Coordinates for d2bcce2:

Click to download the PDB-style file with coordinates for d2bcce2.
(The format of our PDB-style files is described here.)

Timeline for d2bcce2: