SCOPe 2.08: Domain d2bcce2: 2bcc E:1-69

Lineage for d2bcce2 (2bcc E:1-69)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [81498] (3 PDB entries)

8. Domain d2bcce2: 2bcc E:1-69 [43706]
   Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bccf_, d2bccg_, d2bcch_, d2bccj_
   complexed with bog, fes, hem, pee, sig, u10

Details for d2bcce2

PDB Entry: 2bcc, 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

PDB Compounds: (E:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d2bcce2:

Sequence; same for both SEQRES and ATOM records:

>d2bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus) [TaxId: 9031]}
shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
smsasadvl

Timeline for d2bcce2:

• d2bcce2 first appeared (with stable ids) in SCOP 1.55
  
• d2bcce2 appears in SCOPe 2.07