Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) |
Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries) |
Domain d2bccd3: 2bcc D:196-241 [43705] Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_ complexed with bog, fes, hem, pee, sig, u10 |
PDB Entry: 2bcc (more details), 3.5 Å
SCOP Domain Sequences for d2bccd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus)} pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk
Timeline for d2bccd3: