Lineage for d2bccd3 (2bcc D:196-241)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268205Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) (S)
  5. 268206Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 268207Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 268213Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries)
  8. 268215Domain d2bccd3: 2bcc D:196-241 [43705]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bccd3

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus)}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d2bccd3:

Click to download the PDB-style file with coordinates for d2bccd3.
(The format of our PDB-style files is described here.)

Timeline for d2bccd3: