Lineage for d2bcch_ (2bcc H:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268492Fold f.28: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 268493Superfamily f.28.1: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 268494Family f.28.1.1: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 268495Protein Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 268501Species Chicken (Gallus gallus) [TaxId:9031] [81527] (3 PDB entries)
  8. 268503Domain d2bcch_: 2bcc H: [43709]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bccj_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bcch_

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bcch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcch_ f.28.1.1 (H:) Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus)}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
lfnslk

SCOP Domain Coordinates for d2bcch_:

Click to download the PDB-style file with coordinates for d2bcch_.
(The format of our PDB-style files is described here.)

Timeline for d2bcch_: