Lineage for d2bccj_ (2bcc J:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268256Superfamily f.23.14: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 268257Family f.23.14.1: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)
  6. 268258Protein Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    inteacts with cytochrome c1 and ISP
  7. 268264Species Chicken (Gallus gallus) [TaxId:9031] [81510] (3 PDB entries)
  8. 268266Domain d2bccj_: 2bcc J: [43710]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bccj_

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccj_ f.23.14.1 (J:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Chicken (Gallus gallus)}
tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk

SCOP Domain Coordinates for d2bccj_:

Click to download the PDB-style file with coordinates for d2bccj_.
(The format of our PDB-style files is described here.)

Timeline for d2bccj_: