Lineage for d6p9ic_ (6p9i C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756289Domain d6p9ic_: 6p9i C: [411631]
    Other proteins in same PDB: d6p9ib1, d6p9ib2, d6p9id1, d6p9id2
    automated match to d6shgh_

Details for d6p9ic_

PDB Entry: 6p9i (more details), 2.4 Å

PDB Description: crystal structure of human anti staphylococcus aureus antibody stau- 399 fab
PDB Compounds: (C:) human anti staphylococcus aureus antibody STAU-399 Fab heavy chain

SCOPe Domain Sequences for d6p9ic_:

Sequence, based on SEQRES records: (download)

>d6p9ic_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgsslkvsckvsggnlrsygiswvrqapgqglewmgviipifgtpty
aqkfqgrvtlaaddsnnivfmelsslrsedtavyycardwpsitvavdatnygmdvwgqg
tlvtvssasfkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

Sequence, based on observed residues (ATOM records): (download)

>d6p9ic_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgsslkvsckvsggnlrsygiswvrqapgqglewmgviipifgtpty
aqkfqgrvtlaaddsnnivfmelsslrsedtavyycardwpsitvavdatnygmdvwgqg
tlvtvssasfkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

SCOPe Domain Coordinates for d6p9ic_:

Click to download the PDB-style file with coordinates for d6p9ic_.
(The format of our PDB-style files is described here.)

Timeline for d6p9ic_:

  • d6p9ic_ is new in SCOPe 2.08-stable