SCOPe 2.08: Domain d6p9id2: 6p9i D:112-213

Lineage for d6p9id2 (6p9i D:112-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6p9id2: 6p9i D:112-213 [387792]
   Other proteins in same PDB: d6p9ia_, d6p9ib1, d6p9ic_, d6p9id1
   automated match to d2fb4l2

Details for d6p9id2

PDB Entry: 6p9i, 2.4 Å

PDB Description: crystal structure of human anti staphylococcus aureus antibody stau- 399 fab

PDB Compounds: (D:) human anti staphylococcus aureus antibody STAU-399 Fab light chain

SCOPe Domain Sequences for d6p9id2:

Sequence; same for both SEQRES and ATOM records:

>d6p9id2 b.1.1.2 (D:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d6p9id2:

• d6p9id2 first appeared in SCOPe 2.07