Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d6p9id1: 6p9i D:1-111 [387791] Other proteins in same PDB: d6p9ia_, d6p9ib2, d6p9ic_, d6p9id2 automated match to d2mcg11 |
PDB Entry: 6p9i (more details), 2.4 Å
SCOPe Domain Sequences for d6p9id1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p9id1 b.1.1.1 (D:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsaltqprsvsgspgqsvtisctgtsndvgyydhvswyqqhpgkapkfiiydvskrpsgv pdrfsgsksdntasltisglqaedeadyyccsfagsytyvfgtgtkvtvlg
Timeline for d6p9id1:
View in 3D Domains from other chains: (mouse over for more information) d6p9ia_, d6p9ib1, d6p9ib2, d6p9ic_ |