Lineage for d6bfsh_ (6bfs H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744571Domain d6bfsh_: 6bfs H: [410886]
    Other proteins in same PDB: d6bfsc1, d6bfsc2, d6bfsl1, d6bfsl2
    automated match to d6shgh_

Details for d6bfsh_

PDB Entry: 6bfs (more details), 2 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies
PDB Compounds: (H:) Fab heavy chain

SCOPe Domain Sequences for d6bfsh_:

Sequence, based on SEQRES records: (download)

>d6bfsh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklqqsgpelvkpgasvkisckasgysftnyymhwmkqrpgqglewigwifpgsdntky
nekfkgkatltadtssstaymqlssltsedsavyfcarkgttgfaywgqgtlvtvsaakt
tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d6bfsh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklqqsgpelvkpgasvkisckasgysftnyymhwmkqrpgqglewigwifpgsdntky
nekfkgkatltadtssstaymqlssltsedsavyfcarkgttgfaywgqgtlvtvsaakt
tppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
vpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d6bfsh_:

Click to download the PDB-style file with coordinates for d6bfsh_.
(The format of our PDB-style files is described here.)

Timeline for d6bfsh_:

  • d6bfsh_ is new in SCOPe 2.08-stable