Lineage for d6bfsc1 (6bfs C:14-110)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2315782Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2315783Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2315881Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2316037Protein automated matches [190501] (4 species)
    not a true protein
  7. 2316038Species Human (Homo sapiens) [TaxId:9606] [187448] (22 PDB entries)
  8. 3057240Domain d6bfsc1: 6bfs C:14-110 [357302]
    Other proteins in same PDB: d6bfsc2, d6bfsl1, d6bfsl2
    automated match to d5d22b_

Details for d6bfsc1

PDB Entry: 6bfs (more details), 2 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies
PDB Compounds: (C:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d6bfsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfsc1 a.26.1.2 (C:14-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrgsltkl
kgpltmmashykqhcpptpetscatqiitfesfkenl

SCOPe Domain Coordinates for d6bfsc1:

Click to download the PDB-style file with coordinates for d6bfsc1.
(The format of our PDB-style files is described here.)

Timeline for d6bfsc1:

  • d6bfsc1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6bfsc2