Lineage for d6bfsl2 (6bfs L:108-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (522 PDB entries)
  8. 3057572Domain d6bfsl2: 6bfs L:108-212 [357634]
    Other proteins in same PDB: d6bfsc1, d6bfsc2, d6bfsl1
    automated match to d1h3pl2

Details for d6bfsl2

PDB Entry: 6bfs (more details), 2 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6bfsl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bfsl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d6bfsl2:

Click to download the PDB-style file with coordinates for d6bfsl2.
(The format of our PDB-style files is described here.)

Timeline for d6bfsl2:

  • d6bfsl2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6bfsl1