Lineage for d5mvza_ (5mvz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756705Domain d5mvza_: 5mvz A: [410405]
    Other proteins in same PDB: d5mvzu_, d5mvzv_
    automated match to d6shgh_
    complexed with gol

Details for d5mvza_

PDB Entry: 5mvz (more details), 2.15 Å

PDB Description: fab 4ab007 bound to interleukin-1-beta
PDB Compounds: (A:) Fab 4AB007 H-chain

SCOPe Domain Sequences for d5mvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mvza_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgaevkkpgeslkisckgsgytftsywigwvrqmpgkglewmgiiypgdsdtry
spsfqgqvtisadksistaylqwsslkasdtamyycarfvsldafdiwgqgtmvtvssas
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc

SCOPe Domain Coordinates for d5mvza_:

Click to download the PDB-style file with coordinates for d5mvza_.
(The format of our PDB-style files is described here.)

Timeline for d5mvza_:

  • d5mvza_ is new in SCOPe 2.08-stable