Lineage for d5mvzv_ (5mvz V:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053419Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 protein domains)
  6. 2053447Protein Interleukin-1beta [50363] (2 species)
  7. 2053448Species Human (Homo sapiens) [TaxId:9606] [50364] (26 PDB entries)
    Uniprot P01584 117-269
  8. 2286617Domain d5mvzv_: 5mvz V: [329918]
    Other proteins in same PDB: d5mvzb1, d5mvzb2, d5mvzl1, d5mvzl2
    automated match to d2i1ba_
    complexed with gol

Details for d5mvzv_

PDB Entry: 5mvz (more details), 2.15 Å

PDB Description: fab 4ab007 bound to interleukin-1-beta
PDB Compounds: (V:) interleukin-1 beta

SCOPe Domain Sequences for d5mvzv_:

Sequence, based on SEQRES records: (download)

>d5mvzv_ b.42.1.2 (V:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggtkggqditdftmqfvs

Sequence, based on observed residues (ATOM records): (download)

>d5mvzv_ b.42.1.2 (V:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnctlrdsqqkslvmsgpyelkalhlmeqqvvfsmsfvqgsndkipvalglkeknly
lscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyistsqae
nmpvflggtkggqditdftmqfvs

SCOPe Domain Coordinates for d5mvzv_:

Click to download the PDB-style file with coordinates for d5mvzv_.
(The format of our PDB-style files is described here.)

Timeline for d5mvzv_:

  • d5mvzv_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16