Lineage for d5mvzl2 (5mvz L:108-215)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2286661Domain d5mvzl2: 5mvz L:108-215 [329962]
    Other proteins in same PDB: d5mvzu_, d5mvzv_
    automated match to d1h3pl2
    complexed with gol

Details for d5mvzl2

PDB Entry: 5mvz (more details), 2.15 Å

PDB Description: fab 4ab007 bound to interleukin-1-beta
PDB Compounds: (L:) Fab 4AB007 L-chain

SCOPe Domain Sequences for d5mvzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mvzl2 b.1.1.0 (L:108-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgece

SCOPe Domain Coordinates for d5mvzl2:

Click to download the PDB-style file with coordinates for d5mvzl2.
(The format of our PDB-style files is described here.)

Timeline for d5mvzl2:

  • d5mvzl2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16